MNHB2_STAAU Mrp complex subunit B2 Putative antiporter subunit mnhB2 mnhB2 Putative NADH-ubiquinone oxidoreductase subunit mnhB2 Expression of the mnh2 operon in E.coli is not able to catalyze Na(+)Li(+)/H(+) antiport. It does however confer higher growth rates than the control strain at up to pH 9.5. The operon may encode an NADH-ubiquinone oxidoreductase. MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEVLESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELGILFSVVGVIVTVMLSLSGGRS mrpB2 141